주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Prolactin Releasing Peptides (PrRP)
Prolactin Releasing Peptides (PrRP)
Product Name
Prolactin-Releasing Peptide-31 (PrRP-31 ) (Bovine) 
Size
0.5 
Catalog #
AGP-8644 
Molecular Weight
3576.1 
Formula
 
Sequence(One-Letter Code)
SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2  
Sequence(Three-Letter Code)
Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2  
References
 
Storage
-20