주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Prolactin Releasing Peptides (PrRP)
Prolactin Releasing Peptides (PrRP)
Product Name
Prolactin releasing hormone (Rat) 
Size
0.5 
Catalog #
AGP-8142 
Molecular Weight
3595.1 
Formula
 
Sequence(One-Letter Code)
SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2  
Sequence(Three-Letter Code)
Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2  
References
 
Storage
-20