주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Growth Hormone Releasing Factors (GHRF)
Growth Hormone Releasing Factors (GHRF)
Product Name
GHRF (Human, 1-29 Amide) 
Size
0.5 
Catalog #
AGP-8467 
Molecular Weight
3357.9 
Formula
 
Sequence(One-Letter Code)
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2  
Sequence(Three-Letter Code)
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap