주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Growth Hormone Releasing Factors (GHRF)
Growth Hormone Releasing Factors (GHRF)
Product Name
GHRF (Mouse) 
Size
0.5 
Catalog #
AGP-8466 
Molecular Weight
5032.8 
Formula
 
Sequence(One-Letter Code)
HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS  
Sequence(Three-Letter Code)
His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap