주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Glucagons-Like Peptides
Glucagons-Like Peptides
Product Name
Glucagon-Like Peptide-1 (GLP-1) ((Human, 9-36 Amide) 
Size
0.5 
Catalog #
AGP-8757 
Molecular Weight
3089.4 
Formula
 
Sequence(One-Letter Code)
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2  
Sequence(Three-Letter Code)
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap