주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Glucagons-Like Peptides
Glucagons-Like Peptides
Product Name
GLP-2 (Human) 
Size
0.5 
Catalog #
AGP-8048 
Molecular Weight
3766.1 
Formula
 
Sequence(One-Letter Code)
HADGSFSDEMNTILDNLAARDFINWLIQTKITD  
Sequence(Three-Letter Code)
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap