주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Glucagons-Like Peptides
Glucagons-Like Peptides
Product Name
GLP-1 (Human, 7-36 Amide) 
Size
0.5 
Catalog #
AGP-8047 
Molecular Weight
3297.6 
Formula
 
Sequence(One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2  
Sequence(Three-Letter Code)
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap