주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Gastric-Related Peptides
Gastric-Related Peptides
Product Name
Gastrin Releasing Peptide(GRP) (Porcine) 
Size
0.5 
Catalog #
AGP-8389 
Molecular Weight
2805.3 
Formula
 
Sequence(One-Letter Code)
APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2  
Sequence(Three-Letter Code)
Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap