주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Gastric-Related Peptides
Gastric-Related Peptides
Product Name
Gastric Inhibitory Polypeptide(GIP) (Human, 1-42 ) 
Size
0.5 
Catalog #
AGP-8045 
Molecular Weight
4982.5 
Formula
 
Sequence(One-Letter Code)
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ  
Sequence(Three-Letter Code)
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap