주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Endothelins
Endothelins
Product Name
Endothelin-1 (Human, 1-31) 
Size
0.5 
Catalog #
AGP-8218 
Molecular Weight
3628.2 
Formula
 
Sequence(One-Letter Code)
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge : Cys1-Cys15, Cys3-Cys11) 
Sequence(Three-Letter Code)
Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge : Cys1-Cys15, Cys3-Cys11) 
References
 
Storage
-20 
Home | Peptide | Company | Sitemap