주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Defensins
Defensins
Product Name
α-Defensin-1 (Human) 
Size
0.5 
Catalog #
AGP-8095 
Molecular Weight
 
Formula
 
Sequence(One-Letter Code)
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge : Cys2-Cys30, Cys4-Cys19, Cys9-Cys29) 
Sequence(Three-Letter Code)
Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge : Cys2-Cys30, Cys4-Cys19, Cys9-Cys29) 
References
 
Storage
-20 
Home | Peptide | Company | Sitemap