주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
Product Name
α-Defensin-1 (Human) 
Catalog #
Molecular Weight
Sequence(One-Letter Code)
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge : Cys2-Cys30, Cys4-Cys19, Cys9-Cys29) 
Sequence(Three-Letter Code)
Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge : Cys2-Cys30, Cys4-Cys19, Cys9-Cys29) 