주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Corticotropin Releasing Factors (CRF)
Corticotropin Releasing Factors (CRF)
Product Name
CRF (Human, Rat) 
Size
0.5 
Catalog #
AGP-8034 
Molecular Weight
4756.5 
Formula
 
Sequence(One-Letter Code)
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 AGP-8344  
Sequence(Three-Letter Code)
Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap