주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Adrenocorticotropic Hormones (ACTH)
Adrenocorticotropic Hormones (ACTH)
Product Name
ACTH (7-38) / [Corticotropin Inhibiting Peptide (CIP)](Human) 
Size
0.5 
Catalog #
AGP-8699 
Molecular Weight
3659.7 
Formula
 
Sequence(One-Letter Code)
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE  
Sequence(Three-Letter Code)
Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu  
References
 
Storage
-20 
Home | Peptide | Company | Sitemap