주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Brain Natriuretic Peptides (BNP)
Brain Natriuretic Peptides (BNP)
Product Name
BNP-32 (Rat) 
Size
0.5 
Catalog #
AGP-8183 
Molecular Weight
3453 
Formula
 
Sequence(One-Letter Code)
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge : Cys10-Cys26) 
Sequence(Three-Letter Code)
Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge : Cys10-Cys26) 
References
 
Storage
-20 
Home | Peptide | Company | Sitemap