주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Amylins (IAPP)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Amylin (Human, 14-24)32 AGP-8395 NFLVHSSNNFG 1235.3 0.5
Amylin (Human, 1-13)33 AGP-8396 KCNTATCATQRLA 1378.6 0.5
Amylin (74-89), Prepro (Human)34 AGP-8492 NAVEVLKREPLNYLPL 1868.2 0.5
Amylin (Rat)35 AGP-8157 KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 3922.3 0.5
Amyloid β (Human, 1-16)36 AGP-8005 DAEFRHDSGYEVHHQK 0.5
--> Back
Home | Peptide | Company | Sitemap