주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Vasoactive Intestinal Peptides (VIP)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
VIP (Human, Porcine, Rat, Ovine, 10-28)648 AGP-8084 YTRLRKQMAVKKYLNSILN-NH2 2338.8 0.5
PHM-27 (Human)649 AGP-8295 HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 2985.4 0.5
VIP (Human, Porcine)650 AGP-8324 HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 3325.8 0.5
VIP (Human, Porcine, Rat, 1-12)651 AGP-8630 HSDAVFTDNYTR 1425.5 0.5
VIP Antagonist652 AGP-8631 KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 3467.1 0.5
[(4Cl)DPhe6,Leu17]-VIP653 AGP-8632 HSDAV-4-Cl-dFTDNYTRLRKQLAVKKYLNSILN-NH2 3342.1 0.5
VIP1 Agonist : [Lys15,Arg16,Leu27]-VIP (1-7)-GRF (8-27)654 AGP-8633 HSDAVFTNSYRKVLKRLSARKLLQDIL-NH2 3171.7 0.5
VIP1 Antagonist : [Ac-His1,D-Phe2,Lys15,Arg16,Leu27]655 AGP-8634 Ac-H-dF-DAVFTNSYRKVLKRLSARKLLQDIL-NH2 3273.8 0.5
VIP1 Agonist Secretin [Arg16] (Chicken)656 AGP-8635 HSDGLFTSEYSKMRGRAQVQKFIQNLM-NH2 3171.7 0.5
PHI-27 (Porcine)657 AGP-8636 HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 2995.4 0.5
PHI-27 (Rat)658 AGP-8637 HADGVFTSDYSRLLGQISAKKYLESLI-NH2 3011.4 0.5
PHI (1-27)-Gly (Rat)659 AGP-8638 HADGVFTSDYSRLLGQISAKKYLESLIG 3067.6 0.5
PHM-VIP Space Peptide (PHM (111-122) / Prepro VIP)660 AGP-8639 VSSNISEDPVPV 1242.3 0.5
PHM (156-170) (Prepro VIP)661 AGP-8640 SSEGESPDFPEELEK 1679.7 0.5
--> Back
Home | Peptide | Company | Sitemap