주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Urotensins
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Urotensin II (Human)645 AGP-8322 ETPDCFWKYCV 1388.6 0.5
Urotensin II (Rat)646 AGP-8323 Pyr-HGTAPECFWKYCI AGP-8690 1663.9 0.5
UrotensinⅠ(catostomus commersoni)647 AGP-8431 NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 0.5
--> Back
Home | Peptide | Company | Sitemap