주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Stresscopin & Urocortin
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Urocortin (Human)625 AGP-8083 DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 4697.3 0.5
Stresscopin (Human)626 AGP-8315 TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 4367.2 0.5
Stresscopin-Related Peptide (Human)627 AGP-8316 HPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARV-NH2 4687.5 0.5
Urocortin (Rat)628 AGP-8317 DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 4707.3 0.5
Urocortin II (Mouse)629 AGP-8318 VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 4152.9 0.5
Urocortin I (Mouse)630 AGP-8348 VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVGRR-NH2 4522.3 0.5
Urocortin III (Mouse)631 AGP-8349 FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 4173.9 0.5
AntiSauvagine-30 (aSvg-30)632 AGP-8430 d-FHLLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2 3650.3 0.5
Urotensin II (Frog)633 AGP-8688 AGNLSECFWKYCV 1517.8 0.5
Prepro-Urotensin II (102-125) (Human)634 AGP-8691 FQDFSGQDPNILLSHLLARIWKPY 2859.3 0.5
--> Back
Home | Peptide | Company | Sitemap