주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Somatostatin613 AGP-8099 AGCKNFFWKTFTSC 1639.9 0.5
[D-Trp8]-Somatostatin614 AGP-8312 AGCKNFFdWKTFTSC 1634.9 0.5
[Tyr1]-Somatostatin615 AGP-8313 YGCKNFFWKTFTSC 1730 0.5
Antrin / Pro-Somatostatin (1-10) / Prepro-Somatostatin (25-34)616 AGP-8670 APSDPRLRQF 1186.4 0.5
Pro-Somatostatin (1-32) / N-Terminal Prepro-Somatostatin (Porcine)617 AGP-8671 APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL 3532.1 0.5
Somatostatin-25618 AGP-8672 SNPAMAPRERKAGCKNFFWKTFTSC 2876.3 0.5
Somatostatin-28619 AGP-8673 SANSNPAMAPRERKAGCKNFFWKTFTSC 3150.6 0.5
Somatostatin-28 (1-12)620 AGP-8674 SANSNPAMAPRE 1243.6 0.5
Somatostatin-28 (1-14)621 AGP-8675 SANSNPAMAPRERK 1527.8 0.5
Somatostatin Analog RC-160622 AGP-8676 dFCYdWKVCW-NH2 1130.5 0.5
Cortistatin-29 (Rat, 1-13)623 AGP-8678 Pyr-ERPPLQQPPHRD 1580.7 0.5
Cortistatin-17 (Human)624 AGP-8679 DRMPCRNFFWKTFSSCK 2151.5 0.5
Neuronostatin- 13 (Human)674 AGP-8845 LRQFLQKSLAAAA-NH2 1415.7 0.5
--> Back