주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Laminin Pentapeptide LPLRF-NH2582 AGP-8050 LPLRF-NH2 643.8 1
FMRF-Amide583 AGP-8263 FMRF-NH 599.7 1
RFamide-Related Peptide-1 (Human)584 AGP-8303 SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2 4257 0.1
Cardioexcitatory Peptide 1 (ACEP-1) (Achatina fulica)585 AGP-8397 SGQSWRPQGRF-NH2 1304.4 0.5
FMRF-Like Peptide from Lymnase stagnails586 AGP-8398 GDPFLRF-NH2 849.9 0.5
FMRF-Like Peptide from snail helix Aspersa587 AGP-8399 Pyr-DPFLRF-NH2 905.1 0.5
FMRF-Like Peptide588 AGP-8400 SDPFLRF-NH2 880.1 0.5
F1 peptide, lobster589 AGP-8401 TNRNFLRF-NH2 1066.2 0.5
Y-M-R-F-NH2590 AGP-8402 YMRF-NH2 614.8 1
RFRP-1 (Human)591 AGP-8662 MPHSFANLPLRF-NH2 1428.7 0.5
RFRP-2 (Human)592 AGP-8663 SAGATANLPLRS-NH2 1156.3 0.5
RFRP-3 (Human)593 AGP-8664 VPNLPQRF-NH2 969.2 0.5
RFRP-1 (Rat, Mouse)594 AGP-8665 VPHSAANLPLRF-NH2 1320.6 0.5
RFRP [Prepro] (Rat, 103-125 Amide)595 AGP-8666 SPRARANMEAGTMSHFPSLPQRF-NH2 2588 0.5
Antho-RWamide I596 AGP-8703 Pyr-SLRW-NH2 671.7 0.5
Lys4-Antho-RWamide I597 AGP-8704 Pyr-SLKW-NH2 642 0.5
Trp7-NF1598 AGP-8705 NRNFLRW-NH2 1005 0.5
Gly4,Trp7-NF1599 AGP-8706 NRNGLRW-NH2 914 0.5
Asn3-Antho-RWamide II600 AGP-8707 Pyr-GNRW-NH2 641.6 0.5
Glu1,Lys4-Antho-RWamide I601 AGP-8708 ESLKW-NH2 660 0.5
Ser3-Antho-RWamide II602 AGP-8709 Pyr-GSRW-NH2 614.6 0.5
Glu1,Ala4-Antho-RWamide I603 AGP-8710 ESLAW-NH2 603.7 0.5
Tyr3-Antho-RWamide II604 AGP-8711 Pyr-GYRW-NH2 690.7 0.5
Antho-RWamide I [Ala4]605 AGP-8712 Pyr-SLAW-NH2 585.6 0.5
RFamide- Related Peptide- 3 (Rat)669 AGP-8840 ANMEAGTMSHFPSLPQRF-NH2 2020.3 0.5
--> Back