주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Prolactin Releasing Peptides (PrRP)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Prolactin releasing hormone (Rat)576 AGP-8142 SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 3595.1 0.5
Prolactin-Releasing Peptide-31 (PrRP-31) (Human)577 AGP-8302 SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 3664.2 0.5
Prolactin-Releasing Peptide-20 (PrRP-20) (Human)578 AGP-8642 TPDINPAWYASRGIRPVGRF-NH2 2272.6 0.5
Prolactin-Releasing Peptide-20 (PrRP-20) (Rat)579 AGP-8643 TPDINPAWYTGRGIRPVGRF-NH2 2272.6 0.5
Prolactin-Releasing Peptide-31 (PrRP-31 ) (Bovine)580 AGP-8644 SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 3576.1 0.5
Prolactin-Releasing Peptide-20 (PrRP-20) (Bovine)581 AGP-8645 TPDINPAWYAGRGIRPVGRF-NH2 2242.6 0.5
--> Back
Home | Peptide | Company | Sitemap