주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Peptides YY
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Peptide YY (Human, 3-36)569 AGP-8296 IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 4049.5 0.5
Peptide YY (Human)570 AGP-8341 YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 4309.8 0.5
Peptide YY (PYY) (Porcine, Rat)571 AGP-8548 YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 4240.7 0.5
Peptide YY (PYY) (Porcine, Rat, 13-36)572 AGP-8549 SPEELSRYYASLRHYLNLVTRQRY-NH2 3014.4 0.5
Oxyntomodulin JP10-260573 AGP-8823 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
--> Back
Home | Peptide | Company | Sitemap