주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Parathyroid Hormone & Analogs (PTH)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
PTH-rP (Human, 7-34 Amide)541 AGP-8057 LLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 3364.9 0.5
PTH (Human, 1-34)542 AGP-8127 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 4117.7 0.5
Parathyroid Hormone (Human, 1-31 Amide)543 AGP-8283 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV-NH2 3718.3 0.5
Parathyroid Hormone (Human, 1-44)544 AGP-8284 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR 5063.9 0.5
Parathyroid Hormone (Human, 13-34)545 AGP-8285 KHLNSMERVEWLRKKLQDVHNF 2808.2 0.5
Parathyroid Hormone (Human, 39-68)546 AGP-8286 APLAPRDAGSQRPRKKEDNVLVESHEKSLG 3285.7 0.5
Parathyroid Hormone (Human, 39-84)547 AGP-8287 APLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ 4984.5 0.5
Parathyroid Hormone (Human, 69-84)548 AGP-8288 EADKADVNVLTKAKSQ 1716.9 0.5
[Nle8,18,Tyr34]-PTH (Human, 1-34)549 AGP-8289 SVSEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY 4097.7 0.5
[Nle8,18,Tyr34]-PTH (Human, 1-34 Amide)550 AGP-8290 SVSEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY-NH2 4096.7 0.5
[Nle8,18,Tyr34]-PTH (Human, 3-34 Amide)551 AGP-8291 SEIQL-Nle-HNLGKHLNS-Nle-ERVEWLRKKLQDVHNY-NH2 3910.5 0.5
[Tyr34]-PTH (Bovine, 1-34 Amide)552 AGP-8292 AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 4123.7 0.5
[Tyr34]-PTH (Bovine, 7-34 Amide)553 AGP-8293 FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 3496.1 0.5
PTH-rP (Human, 1-34 Amide)554 AGP-8294 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA-NH2 4016.6 0.5
Parathyroid Hormone (PTH) (Bovine, 1-34)555 AGP-8647 AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 4108.7 0.5
Parathyroid Hormone (PTH) (Human, 1-38)556 AGP-8648 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG 4458.2 0.5
Parathyroid Hormone (PTH)(44-68)(Human)557 AGP-8649 RDAGSQRPRKKEDNVLVESHEKSLG 2836.1 0.5
Parathyroid Hormone-Related Protein (PTH-RP) (Human, Rat, Mouse, 1-34)558 AGP-8650 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA 4017.6 0.5
[Tyr36]-Parathyroid Hormone-Related Protein (PTH-RP) (Chicken, 1-36 Amide)559 AGP-8651 AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2 4191.7 0.5
[Tyr34]-Parathyroid Hormone-Related Protein (PTH-RP) (Human, 1-34 Amide)560 AGP-8652 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTY-NH2 4108.7 0.5
Parathyroid Hormone-Related Protein (PTH-RP) (Human, 1-37)561 AGP-8653 AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIR 4416.1 0.5
[Asn10.Leu11]-Parathyroid Hormone-Related Protein (PTH-RP) (Human, 7-34 Amide)562 AGP-8655 LLHNLGKSIQDLRRRFFLHHLIAEIHTA-NH2 3348.9 0.5
[Leu11,D-Trp12]-Parathyroid Hormone-Related Protein (PTH-RP) (Human, 7-34 Amide)563 AGP-8656 LLHDLdWKSIQDLRRRFFLHHLIAEIHTA-NH2 3479.8 0.5
Parathyroid Hormone-Related Protein (PTH-RP) (Human, 38-64 Amide)564 AGP-8657 ATSEVSPNSKPSPNTKNHPVRFGSDDE-NH2 2897.1 0.5
Parathyroid Hormone-Related Protein (PTH-RP) (Human, 67-86 Amide)565 AGP-8658 YLTQETNKVETYKEQPLKTP-NH2 2409.7 0.5
Parathyroid Hormone-Related Protein (PTH-RP)(107-111)(Human, Rat, Mouse)566 AGP-8659 TRSAW-NH2 618.7 0.5
Parathyroid Hormone-like Peptide (PLP) (Human, 140-173)567 AGP-8660 TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL 4059.9 0.5
TIP 39 (Tuberoinfundibular Neuropeptide)568 AGP-8661 SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 4504.2 0.5
--> Back
Home | Peptide | Company | Sitemap