주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Pancreatic Polypeptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Pancreatic Polypeptide (PPP) (Human)539 AGP-8550 APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2 4181.8 0.5
Pancreatic Polypeptide (PPP) (Rat)540 AGP-8551 APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 4398.9 0.5
--> Back
Home | Peptide | Company | Sitemap