주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Pancreastatin (Human, 37-52 Amide)532 AGP-8055 EEEEEMAVVPQGLFRG-NH2 1818.8 0.5
Xenin 25 (Human)533 AGP-8329 MLTKFETKSARVKGLSFHPKRPWIL 2971.6 0.5
Pancreastatin (Chromograninin A (Human, 250-301 Amide))534 AGP-8552 GESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 5508.8 0.5
Pancreastatin (24-52) (hPST-29) (Human)535 AGP-8553 PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 3282.5 0.5
Pancreastatin (Porcine, 33-49)537 AGP-8555 QEEEEETAGAPQGLFRG-NH2 1846.9 0.5
Pancreastatin (Chromograninin A (264-314)-Amide) (Rat)538 AGP-8556 DDGQSESQAVNGKTGASEAVPSEGKGELEHSQQEEDGEEAMAGPPQGLFPG-NH2 5169.4 0.5
--> Back