주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
PACAP
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
PACAP 27 (Huaman, 1-27 Amide)525 AGP-8120 HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 3147.6 0.5
PACAP38 (Human)526 AGP-8298 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 4534.3 0.5
PACAP (Human, Ovine, Rat, 6-27)527 AGP-8625 FTDSYSRYRKQMAVKKYLAAVL-NH2 2638.1 0.5
PACAP (Human, Ovine, Rat, 6-38)528 AGP-8626 FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 4024.8 0.5
PACAP-Related Peptide (PRP) (Rat, 12-29)529 AGP-8627 RKVLDQLSARKYLQSMVA 2106.5 0.5
PACAP38 (Human, Ovine, Rat, 31-38)530 AGP-8628 YKQRVKNK-NH2 1062.3 0.5
PACAP-Related Peptide (PRP) (Human)531 AGP-8629 DVAHGILNEAYRKVLDQLSAGKHLQSLVA 3146.6 0.5
--> Back
Home | Peptide | Company | Sitemap