주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Opioid Related Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
BAM-12P485 AGP-8018 YGGFMRRVGRPE 1425.7 0.5
Nociceptin486 AGP-8130 FGGFTGARKSARKLANQ 1809 0.5
Morphine Modulating Peptide, C-terminal Fragment487 AGP-8532 PQRF-NH2 545.6 1
Nociceptin Antagonist488 AGP-8581 Ac-RYYRIK-NH2 939.1 0.5
BAM-22P (Bovine)489 AGP-8605 YGGFMRRVGRPEWWMDYQKRYG 2839.3 0.5
Metorphinamide (Adrenorphin)490 AGP-8615 YGGFMRRV-NH2 984.2 0.5
Peptide E-3200-dalton Adrenal (Bovine)491 AGP-8616 YGGFMRRVGRPEWWMDYQKRYGGFL 3156.6 0.5
Peptide F (Bovine)492 AGP-8617 YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM 3845.4 0.5
[DAla2]-Deltorphin I493 AGP-8623 YdAFDVVG-NH2 768.4 0.5
Casoxin D494 AGP-8624 YVPFPPF 866 0.5
Nocistatin (Bovine)495 AGP-8054 TEPGLEEVGEIEQKQLQ 1926.9 0.5
[Lys8]-Vasopressin496 AGP-8096 CYFQNCPKG-NH2 1056.4 0.5
[Arg8]-Vasopressin497 AGP-8100 CYFQNCPRG-NH2 1084.4 0.5
Nocistatin (Human)498 AGP-8277 MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ 3561.9 0.5
[Arg8]-Vasotocin (Frog, Chicken)499 AGP-8326 CYIQNCPRG-NH2 1050.2 0.5
Diuretic Hormone (Manduca sexta)500 AGP-8432 RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI-NH2 4731.6 0.5
Orphanin FQ (1-7)501 AGP-8566 FGGFTGA 655.7 0.5
Orphanin Pro FQ / Nociceptin(85-119)-Prepro / Nocistatin-35 (Human, Rat, Mouse)502 AGP-8567 MPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ 3907.3 0.5
Orphanin Pro FQ / Nociceptin-Propro (141-157)503 AGP-8568 FSEFMRQYLVLSMQSSQ 2081.4 0.5
Orphanin FQ / [Tyr14]-Nociceptin504 AGP-8569 FGGFTGARKSARKYANQ 1859.1 0.5
Orphanin FQ / [Des-Phe1]-Nociceptin505 AGP-8570 GGFTGARKSARKLANQ 1661.9 0.5
Orphanin FQ / Nociceptin (Human, Rat, Mouse, 1-11)506 AGP-8571 FGGFTGARKSA 1098.2 0.5
Orphanin Prepro FQ / Nociceptin(85-119) /[Tyr0]-Nocistatin-35 (Rat)507 AGP-8572 YMPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ 4070.4 0.5
Orphanin FQ / Nociceptin [Phe=Gly) -(1-13 Amide)508 AGP-8573 [Phe1gamma(CH2 -NH)-Gly2]-GFTGARKSARK-NH2 1376.6 0.5
Orphanin FQ (1-13 Amide)509 AGP-8574 FGGFTGARKSARK-NH2 1381.6 0.5
Orphanin Pro FQ (Rat, 173-181)510 AGP-8575 RTLHQNGNV 1038.1 0.5
Orphanin Pro FQ (Rat, 154-181) / Prepro-OFQ (Mouse, 160-187 Free Acid)511 AGP-8576 FSEFMRQYLVLSMQSSQRRRTLHQNGNV 3413.9 0.5
[Tyr0]-Nocistatin / [Tyr0]-PNP-3 (Bovine)512 AGP-8577 YTEPGLEEVGEIEQKQLQ 2090.3 0.5
[Lys14-E-(Tyr)]-Nocistatin / [Lys14-E-(Tyr)]-PNP-3 (Bovine)513 AGP-8578 TEPGLEEVGEIEQK(Y)QLQ 2090.3 0.5
Nocistatin-41 / PNP-3-8P (Bovine)514 AGP-8579 EIEQKQLQ 1015.1 0.5
Nocistatin-41 / PNP-2/3 (Mouse)515 AGP-8580 MPRVRSLVQVRDAEPGADAEPGADAEPGADDAEEVEQKQLQ 4375.7 0.5
[N-Phe1]-Orphanin FQ (1-13 Amide)516 AGP-8582 N-Benzyl-GGGFTGARKSARK-NH2 1380.46 0.5
--> Back
Home | Peptide | Company | Sitemap