주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Neuropeptide Y
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Neuropeptide Y (NPY)469 AGP-8091 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 4272.7 0.5
[Leu31,Pro34]-NPY (Porcine)470 AGP-8274 YPSKPDNPGEDAPAEDLARYYSALRHYINLLTRPRY-NH2 4223.7 0.5
NPY (Porcine, 13-36)471 AGP-8275 PAEDLARYYSALRHYINLITRQRY-NH2 2982.4 0.5
Neuropeptide Y (NPY) Free Acid (Human)472 AGP-8538 YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY 4272.7 0.5
Neuropeptide Y (NPY) (Porcine)473 AGP-8539 YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 4253.7 0.5
Neuropeptide Y (NPY) (Porcine, 2-36)474 AGP-8540 PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 4090.5 0.5
Neuropeptide Y (NPY) (Porcine, 16-36)475 AGP-8542 DLARYYSALRHYINLITRQRY-NH2 2685.1 0.5
Neuropeptide Y (NPY) (Porcine, 18-36)476 AGP-8543 ARYYSALRHYINLITRQRY-NH2 2456.8 0.5
Neuropeptide Y (NPY) (Porcine, 20-36)477 AGP-8544 YYSALRHYINLITRQRY-NH2 2229.6 0.5
Neuropeptide Y (NPY) (Porcine, 22-36)478 AGP-8545 SALRHYINLITRQRY-NH2 1903.2 0.5
[D-Trp32]-Neuropeptide Y (NPY) (Porcine)479 AGP-8546 YPSKPDNPGEDAPAEDLARYYSALRHYINLIdWRQRY-NH2 4338.8 0.5
Neuropeptide Y (NPY) (Porcine, 3-36)480 AGP-8547 SKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 3993.4 0.5
--> Back
Home | Peptide | Company | Sitemap