주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Eledosin related peptide439 AGP-8037 KFIGLM-NH2 707 0.5
Mastoparan X440 AGP-8112 INWKGIAAMAKKLL-NH2 1556 0.5
Joining Peptide (Rat)441 AGP-8249 AEEETAGGDGRPEPSPRE-NH 1882.9 0.5
Mastoparan442 AGP-8256 INLKALAALAKKIL-NH 1478.9 0.5
Physalaemin443 AGP-8297 Pyr-ADPNKFYGLM-NH2 1265.5 0.5
Neuropeptide GE (Human)445 AGP-8502 GSVDFPAENGVQNTESTQE 2009.1 0.5
Neuropeptide GE / NGE (Rat)446 AGP-8503 GPAVFPAENGVQNTESTQE 1975.1 0.5
Neuropeptide GE (Mouse)447 AGP-8504 GSVAVFPAENGVQNTESTQE 2064.2 0.5
Neuropeptide EI (NEI)448 AGP-8505 EIGDEENSAKFPI-NH2 1447.6 0.5
Neuropeptide AF (huNPAF) (Human)449 AGP-8528 AGEGLNSQFWSLAAPQRF-NH2 1978.2 0.5
Neuropeptide FF (huNPFF) (Human)450 AGP-8529 SQAFLFQPQRF-NH2 1367.6 0.5
Morphine Modulating Neuropeptide / A18Fa / Neuropeptide AF / bNPAF (Bovine)451 AGP-8530 AGEGLSSPFWSLAAPQRF-NH2 1920.2 0.5
Morphine Modulating Neuropeptide (F8Fa) / Neuropeptide FF (bNPFF) (Bovine)452 AGP-8531 FLFQPQRF-NH2 1081.3 0.5
Neuropeptide F (Monieza expansa)453 AGP-8714 PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 4590.4 0.5
[Des-Br]-Neuropeptide B-23 (NPB-23) / L7 (Human)454 AGP-8716 WYKPAAGHSSYSVGRAAGLLSGL 2348.7 0.5
Neuropeptide W-23 (NPW-23) / L8 (Human)455 AGP-8718 WYKHVASPRYHTVGRAAGLLMGL 2584.1 0.5
[Des-Br]-Neuropeptide B-29 (NPB-29) (Human)456 AGP-8719 WYKPAAGHSSYSVGRAAGLLSGLRRSPYA 3079.5 0.5
Neuropeptide W-30 (NPW-30) (Human)457 AGP-8722 WYKHVASPRYHTVGRAAGLLMGLRRSPYLW 3543.2 0.5
Neuropeptide W-23 (NPW-23) (Rat)458 AGP-8723 WYKHVASPRYHTVGRASGLLMGL 2600.1 0.5
Neuropeptide W-23 (NPW-23) (Porcine)459 AGP-8724 WYKHTASPRYHTVGRAAGLLMGL 2586 0.5
Neuropeptide S (NPS) (Rat)460 AGP-8772 SFRNGVGSGVKKTSFRRAKQ 2210.5 0.5
Neuropeptide S (NPS) (Human)461 AGP-8773 SFRNGVGTGMKKTSFQRAKS 2187.5 0.5
Neuropeptide S (NPS) (Mouse, 1-15)462 AGP-8774 SFRNGVGSGAKKTSF 1542.7 0.5
Neuropeptide S (NPS) (Rat, 1-15)463 AGP-8775 SFRNGVGSGVKKTSF 1570.8 0.5
[Tyr10]-Neuropeptide S (NPS) (Rat, Mouse)464 AGP-8776 SFRNGVGSGYKKTSFRRAKQ 2274.6 0.5
Neuropeptide S (NPS) (Mouse)465 AGP-8792 SFRNGVGSGAKKTSFRRAKQ 2182.5 0.5
NAP / NAPVSIPQ466 AGP-8804 NAPVSIPQ 824.9 0.5
Neuropeptide S (NPS) (Chimpanzee, Canine)467 AGP-8806 SFRNGVGTGMKKTSFRRAKS 2215.5 0.5
Neuropeptide S (NPS) (Chicken)468 AGP-8807 SFRNGVGSGIKKTSFRRAKS(2183.50) 2183.5 0.5
--> Back