주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
Miscellaneous Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Platelet factor-4 (Human, 58-70)364 AGP-8059 PLYKKIIKKLLES 1573 0.5
Calgranulin C367 AGP-8113 VAIALKAAHYHTHKE 1688.9 0.5
Lactoferrin368 AGP-8117 FKCRRWQWRMKKLGAPSITCVRRAFA 3194.9 0.5
α-Mating Factor369 AGP-8132 WHWLQLKPGQPMY 0.5
Delta Sleep-Inducing Peptide370 AGP-8212 WAGGDASGE 848.8 0.5
TVL371 AGP-8305 TVL 331.4 1
Serum Thymic Factor372 AGP-8309 Pyr-AKSQGGSN 858.9 0.5
Tuftsin373 AGP-8321 TKPR 500.6 1
Eledoisin374 AGP-8333 Pyr-PSKDAFIGLM-NH2 1183.3 0.5
Angiomax375 AGP-8334 d F-PRPGGGGNGDFEEIPEEYL 2180.3 0.5
Thymalfasin376 AGP-8336 Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN 3108.3 0.5
Manserin rat Nerotransmitter-Regulator377 AGP-8343 VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVS 4368.7 0.5
N-Formyl-Nle-LF-Nle-Y-K378 AGP-8446 Nformyl-Nle-LF-Nle-YK 823.5 0.5
N-Formyl-M-I-L-F379 AGP-8447 Nformyl-MILF 550.3 0.5
N-Formyl-M-I-F-L380 AGP-8448 Nformyl-MIFL 550.3 0.5
N-Formyl-M-L-I-F381 AGP-8449 Nformyl-MLIF 550.3 0.5
N-Formyl-M-L-F382 AGP-8450 N-Formyl-MLF 437.2 0.5
N-Formyl-M-L-F-I383 AGP-8451 Nformyl-MLFI 550.3 0.5
N-Formyl-M-L-F-K384 AGP-8452 Nformyl-MLFK 565.3 0.5
Kyotorphin385 AGP-8620 YR 337.2 0.5
Aleucokinin-like Peptide Receptor ligand387 AGP-8646 PSFHSWS-NH2 845.9 0.5
Thrombin Receptor Agonist388 AGP-8686 SFLLRNPNDKYEPF 1738.9 0.5
WKYMVM389 AGP-8694 WKYMVM-NH2 856.1 0.5
WKYMVdM-NH2390 AGP-8695 WKYMVdM-NH2 856.1 0.5
Hypothetical Protein XP_294524 (171-196 Amide) / P518 / QRFP-26 (Human)394 AGP-8747 TSGPLGNLAEELNGYSRKKGGFSFRF-NH2 2832.2 0.5
Hypothetical Protein XP_149121 (97-122 Amide) / P550 (Mouse)395 AGP-8748 ASGPLGTLAEELSSYSRRKGGFSFRF-NH2 2820.2 0.5
Hemokinin-1 (HK-1) (Human)396 AGP-8749 TGKASQFFGLM-NH2 1185.4 0.5
Hemokinin-1 (HK-1) (Mouse)397 AGP-8750 RSRTRQFYGLM-NH2 1413.7 0.5
Hemokinin-1 (HK-1) (4-11) (Human)398 AGP-8751 ASQFFGLM-NH2 899.1 0.5
Endokinin A/B399 AGP-8752 GKASQFFGLM-NH2 1084.3 0.5
Proctolin400 AGP-8753 RYLPT 648.8 1
AF9401 AGP-8754 GLGPRPLRF-NH2 1011.2 0.5
Pheromone Biosynthesis-Activating Neuropeptide (PBAN Hez) (Heliothis zea)402 AGP-8758 LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL-NH2 3898.8 0.5
Leucopyrokinin (LPK)404 AGP-8760 Pyr-TSFTPRL-NH2 930.5 0.5
Myomodulin405 AGP-8761 PMSMLRL-NH2 845.4 0.5
Chemerin / TIG2 (Human, 145-157)406 AGP-8764 PHSFYFPGQFAFS 1531.7 0.5
Chemerin / TIG2 (Human, 135-154)407 AGP-8765 CLRVQRAGEDPHSFYFPGQF 2354.6 0.5
Ac2-26 (Human) / Lipocortin 1 (2-26) / Annexin-1 (2-26)408 AGP-8767 Ac-AMVSEFLKQAWFIENEEQEYVQTVK 3089.5 0.5
Ac2-12 / Lipocortin 1 / Annexin-1409 AGP-8768 Ac-AMVSEFLKQAW 1351.6 0.5
F2L / HBP (Human, Porcine, Canine, 1-21 Nonacety)410 AGP-8779 MLGMIKNSLFGSVETWPWQVL 2436.9 0.5
F2L / HBP (Rat, Mouse, 1-21 Acetyl)411 AGP-8780 Ac-MLGMIRNSLFGSVETWPWQVL 2506.9 0.5
uPAR (84-95)412 AGP-8781 AVTYSRSRYLEC 1447.6 0.5
uPAR (84-95) (Scrambled peptide)413 AGP-8782 TLVEYYSRASCR 1447.6 0.5
SHAAG peptide (Chemokine 46-63) (Human)414 AGP-8783 MLWRRKITGPQMTLSHAAG 2154.6 0.5
Hemorphin-4 (H-4) (Human, Bovine)415 AGP-8788 YPWT 565.3 1
Thrombin Receptor Agonist Peptide (TRAP1-6)416 AGP-8789 SFLLRN-NH2 747.4 0.5
WRW4, Amide417 AGP-8793 WRWWWW-NH2 1104.3 0.5
F2L/HBP((Human, Porcine, Canine, 1-21 Acetyl)418 AGP-8794 Ac-MLGMIKNSLFGSVETWPWQVL 2478.9 0.5
Antifreeze Polypeptide (AFP) (HPLC-6),419 AGP-8817 DTASDAAAAAALTAANAKAAAELTAANAAAAAAATAR 3242.5 0.5
Flag420 AGP-8822 DYKDDDDK 1012.9 0.5
Phoenixin-14 amide (Human, Rat, Mouse , Porcine, Bovine, Canine)675 AGP-8846 DVQPPGLKVWSDPF-NH2 1583.8 0.5
Phoenixin-15 (Human, Rat, Mouse, Porcine, Bovine, Canine)676 AGP-8847 DVQPPGLKVWSDPFG 1641.8 0.5
Phoenixin-20 amide (Human, Rat, Mouse, Porcine, Bovine)677 AGP-8848 AGIVQEDVQPPGLKVWSDPF 2181.5 0.5
FGF-23(180-205) (Human)/Fibroblast growth factor678 AGP-8849 SAEDDSERDPLNVLKPRARMTPAPAS 2824.2 0.5
--> Back