주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Metastin (Human, 45-54)360 AGP-8260 YNWNSFGLRF-NH 1302.4 0.5
KiSS-1 (94-121 Amide) / Metastin (Human, 27-54 Amide)362 AGP-8692 IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 3229.7 0.5
[pGlu26]-Metastin (Human. 26-54 Amide)363 AGP-8693 Pyr-IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 3342.7 0.5
Peptide 234670 AGP-8841 Ac-dANWNGFGdWRF-NH2 1295.4 0.5
Kisspeptin- 10 (Rat)/Metastin (Rat, 43- 52)671 AGP-8842 YNWNSFGLRY-NH2 1318.4 0.5
p234 penetratin - Kisspeptin Antagonist672 AGP-8843 RRMKWKKYdANWNGFGdWRF-NH2 2429.9 0.5
--> Back