주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Adrenomedullins
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Proadrenomedullin (PAMP) (Human)14 AGP-8002 ARLDVASEFRKKWNKWALSR-NH2 2461.5 0.5
Proadrenomedullin (PAMP) (Rat)15 AGP-8003 ARLDTSSQFRKKWNKWALSR-NH2 2478.3 0.5
Proadrenomedullin-12 (PAMP-12) (Human)16 AGP-8004 FRKKWNKWALSR-NH2 1620.9 0.5
Adrenomedullin (Human, 1-25)17 AGP-8152 YRQSMNNFQGLRSFGCRFGTCTVQK 2926.3 0.5
Adrenomedullin (Human, 1-12)18 AGP-8410 YRQSMNNFQGLR 1513.7 0.5
Adrenomedullin (Human, 13-52)19 AGP-8411 SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 4533.1 0.5
Adrenomedullin (Human, 22-52)20 AGP-8412 TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 3576 0.5
Adrenomedullin (Human, 16-52)21 AGP-8413 CRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 4242.8 0.5
Adrenomedullin (Human, 34-52)22 AGP-8414 TDKDKDNVAPRSKISPQGY-NH2 2118.3 0.5
Adrenomedullin (PAMP-20) (Mouse)23 AGP-8415 AGPDTPSQFRKKWNKWALSR-NH2 2372.7 0.5
Adrenomedullin (Rat, 24-50)24 AGP-8416 LAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 3121.5 0.5
Adrenomedullin (PAMP-20) (Porcine)25 AGP-8418 ARLDVAAEFRKKWNKWALSR-NH2 2444.9 0.5
Adrenomedullin (Porcine, 26-52)26 AGP-8419 LAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 3062.4 0.5
Adrenomedullin (Porcine, 34-52)27 AGP-8420 TDKDKDGVAPRSKISPQGY-NH2 2061.3 0.5
--> Back
Home | Peptide | Company | Sitemap