주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
Growth Hormone Releasing Factors (GHRF)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
GHRF (Human, 1-29 Amide)319 AGP-8467 YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 3357.9 0.5
[Ac-Y1,D-F2]-GHRF (1-29 Amide)321 AGP-8469 Ac-YdFDAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 3476.3 0.5
[N-Ac-Y1,D-R2]-GHRF (Human, 1-29 Amide)322 AGP-8470 Ac-YdRDAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 3485.1 0.5
GHRF (Human, 30-44 Amide)324 AGP-8472 Pyr-QGESNQERGARARL-NH2 1681.8 0.5
GHRP-6325 AGP-8475 HdWAWdFK-NH2 873.1 0.5
--> Back