주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
Glucagons-Like Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
GLP-1 (Human, 7-36 Amide)304 AGP-8047 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 3297.6 0.5
Glucagon (Human)306 AGP-8238 HSQGTFTSDYSKYLDSRRAQDFVQWLMNT 3482.8 0.5
Glucagon-Like peptide (1-36)307 AGP-8345 HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 4141.5 0.5
Glucagon (Dogfish, Scyliorhinus Canidula)309 AGP-8495 HSEGTFTSDYSKYMDNRRAKDFVQWLMNT 3528.9 0.5
Glucagon (Human, 22-29)310 AGP-8497 FVQWLMNT 1038.2 0.5
Glicentin-related Polypeptide (Human)311 AGP-8756 QDTEEKSRSLRSFSASQADPLSDPDQMNED 3384.5 0.5
Glucagon-Like Peptide-1 (GLP-1) ((Human, 9-36 Amide)312 AGP-8757 EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 3089.4 0.5
Taspoglutide313 AGP-8824 H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVK-Aib-R-NH2 3339.6 0.5
Liraglutide315 AGP-8826 HAEGTFTSDVSSYLEGQAAK( 3751.2 0.5
--> Back