주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
Adrenocorticotropic Hormones (ACTH)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
ACTH (Human, 18-39)7 AGP-8075 RPVKVYPNGAEDESAEAFPLEF 2465.7 0.5
ACTH (Human, 1-24)8 AGP-8076 SYSMEHFRWGKPVGKKRRPVKVYP 2933.5 0.5
[D-Arg8]-ACTH (4-10)12 AGP-8698 MEHFdRWG 962.1 0.5
ACTH (7-38) / [Corticotropin Inhibiting Peptide (CIP)](Human)13 AGP-8699 FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE 3659.7 0.5
--> Back