주메뉴바로가기 본문바로가기
Catalog Peptides


Catalog Peptides

  1. HOME
  3. Catalog Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Ghrelin (Human)284 AGP-8147 GSS(n-octanoyl)FLSPEHQRVQQRKESKKPPAKLQPR 3370.9 0.5
[Des-Octanoyl]-Ghrelin (Human)285 AGP-8148 GSSFLSPEHQRVQQRKESKKPPAKLQPR 3244.7 0.5
Ghrelin (Rat)286 AGP-8149 GSS(n-octanoyl)FLSPEHQKAQQRKESKKPPAKLQPR 3314.8 0.5
[Des-Octanoyl]-Ghrelin (Rat)287 AGP-8150 GSSFLSPEHQKAQQRKESKKPPAKLQPR 3188.6 0.5
Ghrelin (Human, 1-14)288 AGP-8476 GSS(n-octanoyl)FLSPEHQRVQQ 1725.9 0.5
Ghrelin (1-5 Amide)289 AGP-8477 GSS(n-octanoyl)FL-NH2 635.8 0.5
[Des-Octanoyl3]-Ghrelin (1-5 Amide)290 AGP-8478 GSS(Des-octanoyl)FL-NH2 508.1 0.5
Ghrelin (Human, Rat, 17-28)291 AGP-8479 ESKKPPAKLQPR 1378.6 0.5
[Des-Octanoyl3]-Ghrelin (Rat)292 AGP-8480 GSS(DesOctanoyl)FLSPEHQKAQQRKESKKPPAKLQPR 3188.6 0.5
Ghrelin C-terminal, Hexapeptide293 AGP-8481 AKLQPR 711.9 0.5
[Des-Octanoyl3]-Ghrelin (Human, 1-14)294 AGP-8482 GSS(Des-octanoyl)FLSPEHQRVQQ 1599.7 0.5
Ghrelin (Rat, 3-28)295 AGP-8483 S(Octanoyl)FLSPEHQKAQQRKESKKPPAKLQPR 3170 0.5
[Des-Q14]-Ghrelin (Rat)296 AGP-8484 GSS(n-octanoyl)FLSPEHQKAQRKESKKPPAKLQPR 3185.9 0.5
[Des-Octanoyl]-Ghrelin (Human, 1-18)297 AGP-8485 GSSFLSPEHQRVQQRKES 2100.3 0.5
Ghrelin (86-117), Prepro (Human)298 AGP-8486 LSGVQYQQHSQALGKFLQDILWEEAKEAPADK 3629 0.5
Ghrelin (52-85), Prepro (Human)299 AGP-8487 ALAGWLRPEDGGQAEQAEDELEVRFNAPFDVGIK 3729.1 0.5
[Des-Octanoyl-Ser3]-Ghrelin (Human)300 AGP-8488 GSS(DesOctanoyl)FLSPEHQRVQQRKESKKPPAKLQPR 3244.7 0.5
Ghrelin (86-117), Prepro (Rat)301 AGP-8489 LSGAQYQQHGRALGKFLQDILWEEVKEAPANK 3626.1 0.5
Ghrelin (52-85), Prepro (Rat)302 AGP-8490 ALEGWLHPEDRGQAEEAEEELEIRFNAPFDVGIK 3896.2 0.5
--> Back