주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Gastric-Related Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Gastrin I (Human)274 AGP-8044 Pyr-GPWLEEEEEAYGWMDF-NH2 2098.8 0.5
Gastric Inhibitory Polypeptide(GIP) (Human, 1-42 )275 AGP-8045 YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ 4982.5 0.5
Gastrin Relesing Peptide (GRP) (Human)276 AGP-8237 VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH 2860.4 0.5
Gastrin Releasing Peptide(GRP) (Porcine)277 AGP-8389 APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 2805.3 0.5
Gastrin Releasing Peptide (Porcine, Human, 14-27)278 AGP-8390 MYPRGNHWAVGHLM-NH2 1667.9 0.5
Big Gastrin I (Human)279 AGP-8423 Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2 AGP-8235 3849.3 0.5
Gastrin Relesing Peptide(GRP) (Human, 1-16)280 AGP-8424 VPLPAGGGTVLTKMYP 1600.9 0.5
CTFP of Rat Progastrin281 AGP-8425 SAEEEDQYN 1084.2 0.5
Gastrin Little (Rat)282 AGP-8426 Pyr-RPPMEEEEEAYGWMDF-NH2 2126.3 0.5
Minigastrin283 AGP-8427 WLEEEEEAYGWMDF-NH2 1832.9 0.5
--> Back
Home | Peptide | Company | Sitemap