주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Galanins-Related Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Galanin (Rat)260 AGP-8043 GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 3164.5 0.5
Galanin (Human)261 AGP-8233 GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS 3157.4 0.5
Galanin-Like Pepdide (Human, 1-60)262 AGP-8234 APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS 6500.3 0.1
Galanin (Bovine)263 AGP-8453 GWTLNSAGYLLGPHALDSHRSFQDKHGLA-NH2 3148.5 0.5
Galanin (Porcine)264 AGP-8454 GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 3210.5 0.5
Galanin (108-123), Prepro (Porcine)265 AGP-8455 LPGLPSAASSEDAGQS 1486.5 0.5
Galanin (Porcine, Rat, 1-16)266 AGP-8456 GWTLNSAGYLLGPHAI 1669.9 0.5
Galanin (Human, 1-19)267 AGP-8457 GWTLNSAGYLLGPHAVGNH 1964.2 0.5
Galanin (1-30), Prepro (Human)268 AGP-8458 MARGSALLLASLLLAAALSASAGLWSPAKE 2940.5 0.5
Galanin (89-105 Amide), Prepro (Porcine)269 AGP-8460 TIMEFLAFLHLKEAGAL-NH2 1903.3 0.5
Galanin (80-105, Amide), Prepro (Porcine)270 AGP-8461 LQSEDKAIRTIMEFLAFLHLKEAGAL-NH2 2944.5 0.5
Galanin(1-13)-P-P-(A-L)2-A-Amide, M40271 AGP-8462 GWTLNSAGYLLGPPPALALA-NH2 1981.3 0.5
Galanin Like Pepitde (GALP) (Human, 36-60)272 AGP-8463 ETALEILDLWKAIDGLPYSHPPQPS 2791.2 0.5
Galanin Like Pepitde (GALP) (Rat)273 AGP-8465 APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT 6502.4 0.5
--> Back
Home | Peptide | Company | Sitemap