주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Exendins
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Exendin-3241 AGP-8089 HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 4202.6 0.5
Exendin-4242 AGP-8090 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 4186.9 0.5
Exendin (5-39)243 AGP-8232 TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH 3806.5 0.5
Exendin-3 (9-39 Amide) (Heloderma horridum)244 AGP-8494 DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 3369.8 0.5
--> Back
Home | Peptide | Company | Sitemap