주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Endothelins
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Suc-[Glu9,Ala11,15] Endothelin (8-21)211 AGP-8040 Suc-DEEAVYFAHLDIIW AGP8442 1821.8 0.5
Endothelin-1 (Human)212 AGP-8139 CSCSSLMDKECVYFCHLDIIW 2491.9 0.5
Endothelin-1 (Human, 1-31)213 AGP-8218 CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY 3628.2 0.5
Endothelin-2 (Human)214 AGP-8219 CSCSSWLDKECVYFCHLDIIW 2547 0.5
Endothelin-3 (Human)215 AGP-8220 CTCFTYKDKECVYYCHLDIIW 2643.1 0.5
Big Endothelin-2 (Human, 1-37)216 AGP-8223 CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP 4183.7 0.5
Big Endothelin-3 (Human, 1-41 Amide)217 AGP-8225 CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2 4923.6 0.5
VIC (Mouse)218 AGP-8227 CSCNSWLDKECVYFCHLDIIW 2574 0.5
Endothelin-1 Prepro (Human, 18-50)219 AGP-8433 APETAVLGAELSAVGENGGEKPTPSPPWRLRRS 3430.8 0.5
Endothelin-1(ET-1) (22-38), Big(Human)220 AGP-8434 VNTPEHVVPYGLGSPRS 1809 0.5
[Ala 11,15]-Endothelin-1 (Human, Porcine, Canine, Rat, Mouse, Bovine, 6-21)221 AGP-8435 LMDKEAVYFAHLDIIW 1964.3 0.5
Endothelin-3 (Human, 22-41 Amide)222 AGP-8437 INTPEQTVPYGLSNYRGSFR-NH2 2298.5 0.5
Endothelin Antagonist, BQ123223 AGP-8440 Cyclo(D-Asp-Pro-D-Val-Leu-D-Trp) 610.3 0.5
--> Back
Home | Peptide | Company | Sitemap