주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Endorphin
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
α-Neo-Endorphin (Porcine)197 AGP-8051 YGGFLRKYPK 0.5
β-Neo-Endorphin (Porcine)198 AGP-8052 YGGFLRKYP 0.5
β-Endorphin (Human)199 AGP-8078 YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE 0.5
α-Endorphin / β-Lipotropin (61-76)200 AGP-8216 YGGFMTSEKSQTPLVT 0.5
γ-Endorphin / β-Lipotropin (61-77)201 AGP-8217 YGGFMTSEKSQTPLVTL 0.5
Endorphin, Ac-beta (1-16) (Human)202 AGP-8595 Ac-YGGFMTSEKSQTPLVT 1787.9 0.5
Endorphin (1-27) Ac-Beta (Camel, Bovine, Ovine)203 AGP-8596 Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAH 3038.5 0.5
Endorphin (1-27) Beta (Camel, Bovine, Ovine)204 AGP-8597 YGGFMTSEKSQTPLVTLFKNAIIKNAH 2996.5 0.5
Endorphin (1-27) Ac-Beta (Human)205 AGP-8598 Ac-YGGFMTSEKSQTPLVTLFKNAIIKNAY 3064.5 0.5
Endorphin (1-26) Beta (Human)206 AGP-8599 YGGFMTSEKSQTPLVTLFKNAIIKNA 2859.3 0.5
Endorphin (1-27) Beta (Human)207 AGP-8600 YGGFMTSEKSQTPLVTLFKNAIIKNAY 3022.5 0.5
Endorphin (18-31) Beta (Human)208 AGP-8601 KKGE 460.5 1
Endorphin Beta (Porcine)209 AGP-8602 YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ 3423.9 0.5
Endorphin Beta (Rat)210 AGP-8603 YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ 3466.1 0.5
--> Back
Home | Peptide | Company | Sitemap