주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Defensins
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
α-Defensin-1 (Human)178 AGP-8095 ACYCRIPACIAGERRYGTCIYQGRLWAFCC 0.5
--> Back
Home | Peptide | Company | Sitemap