주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Corticotropin Releasing Factors (CRF)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
CRF (Human, Rat)153 AGP-8034 SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 AGP-8344 4756.5 0.5
CRF (Ovine)154 AGP-8035 SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 4669.5 0.5
Tyrosyl-CRF (Human, Rat)155 AGP-8205 YSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH 4290.7 0.5
CRF Antagonist [Alpha-Helical CRF(9-41)]156 AGP-8429 DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2 3826.4 0.5
--> Back
Home | Peptide | Company | Sitemap