주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Brain Natriuretic Peptides (BNP)
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
BNP-32 (Human)120 AGP-8180 SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH 3464.1 0.5
BNP-26 (Porcine)121 AGP-8182 DSGCFGRRLDRIGSLSGLGCNVLRRY 2869.3 0.5
BNP-32 (Rat)122 AGP-8183 NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF 3453 0.5
BNP (1-21)123 AGP-8368 HPLGSPGSASDLETS GLQEQR 2166.3 0.5
BNP (22-46)124 AGP-8369 NHLQGKLSELQVEQTSLEPLQESPR 2859.2 0.5
BNP (1-46)125 AGP-8370 HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPR 5009.4 0.5
BNP (24-45)126 AGP-8372 EKSEEMAQRQLSKDQGPTKELL 2545.8 0.5
--> Back
Home | Peptide | Company | Sitemap