주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Atrial Natriuretic Peptides (ANP)-Related Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
ANP (Human, 1-28)86 AGP-8164 SLRRSSCFGGRMDRIGAQSGLGCNSFRY 3080.5 0.5
[Met(O)12]-ANP (Human, 1-28)87 AGP-8165 SLRRSSCFGGR-M(O)-DRIGAQSGLGCNSFRY 3096.5 0.5
ANP (Human, 5-27)88 AGP-8166 SSCFGGRMDRIGAQSGLGCNSFR 2404.7 0.5
ANP (Human, 5-28)89 AGP-8167 SSCFGGRMDRIGAQSGLGCNSFRY 2567.9 0.5
ANP (Human, 7-28)90 AGP-8168 CFGGRMDRIGAQSGLGCNSFRY 2393.7 0.5
ANP (Rat, 1-28)91 AGP-8170 SLRRSSCFGGRIDRIGAQSGLGCNSFRY 3062.5 0.5
ANP (Rat, 3-28)92 AGP-8171 RRSSCFGGRIDRIGAQSGLGCNSFRY 2862.2 0.5
Des[Gln18,Ser19,Gly20,22,Leu21]-ANP (Rat, 4-23 Amide)93 AGP-8360 RSSCFGGRIDRIGAC-NH2 1594.8 0.5
ANP (26-55)94 AGP-8364 NPMYNAVSNADLMDFKNLLDHLEEKMPLED 3508 0.5
ANP (56-92)95 AGP-8365 EVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQR 3878.3 0.5
ANP (104-123)96 AGP-8366 SSDRSALLKSKLRAL LTAPR 2183.6 0.5
--> Back
Home | Peptide | Company | Sitemap