주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Apelins
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
[Pyr1]-Apelin-13 (Human, Bovine)78 AGP-8015 Pyr-RPRLSHKGPMPF 1534.8 0.5
Apelin-36 (Human)79 AGP-8163 LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF 4195.9 0.1
Apelin-36 (Bovine)80 AGP-8350 LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF 4178.9 0.5
Apelin-17 (Human, Bovine)81 AGP-8351 KFRRQRPRLSHKGPMPF 2138.6 0.5
Apelin-16 (Human, Bovine)82 AGP-8352 FRRQRPRLSHKGPMPF 2010.4 0.5
Apelin-13 (Human, Bovine)83 AGP-8353 QRPRLSHKGPMPF 1550.9 0.5
Apelin-12 (Human, Bovine, Mouse, Rat)84 AGP-8354 RPRLSHKGPMPF 1422.7 0.5
Apelin (23-57), Prepro(Human)85 AGP-8355 GSLMPLPDGNGLEDG NVRHLVQPRGSRNGP GPWQG-NH2 3666 0.5
--> Back
Home | Peptide | Company | Sitemap