주메뉴바로가기 본문바로가기
Catalog Peptides

PEPTIDES

Catalog Peptides

  1. HOME
  2. PEPTIDES
  3. Catalog Peptides
Antibiotic Peptides
가격 / Normal Peptide Price
Product Name Catalog# Sequence M.W. Size
Buforin 265 AGP-8085 TRSSRAGLQFPVGRVHRLLRK 2434.9 0.5
Magainin 166 AGP-8086 GIGKFLHSAGKFGKAFVGEIMKS 2409.9 0.5
Magainin 267 AGP-8087 GIGKFLHSAKKFGKAFVGEIMNS 2466.9 0.5
Lactoferricin (Bovine)68 AGP-8088 RRWQWRMKKLG 1544.9 0.5
Gaegurin 469 AGP-8103 GILDTLKQFAKGVGKDLVKGAAQ 2357.8 0.5
Polyphemusin 170 AGP-8104 RRWCFRVCYRGFCYRKCR-NH2 2454 0.5
PMAP-2371 AGP-8105 RIIDLLWRVRRPQKPKFVTVWVR-NH2 2962.6 0.5
Melittin72 AGP-8107 GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 2847.5 0.5
Pleurocidin 273 AGP-8111 GWGSFFKKAAHVGKHVGKAALTHYL 2711.2 0.5
Cecropin A (Porcine)74 AGP-8114 KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 4003.8 0.5
Histatin 5 (Human)75 AGP-8244 DSHAKRHHGYKRKFHEKHHSHRGY 3036.3 0.5
LL37 (Human)76 AGP-8790 [LL-37, 37 aa] 4493.4 0.5
Parasin I77 AGP-8819 KGRGKQGGKLVRAKAKTRSS 2113.5 0.5
Dermcidin- 1L (Human)673 AGP-8844 SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL 4818.4 0.5
--> Back
Home | Peptide | Company | Sitemap